About

Hey! Welcome to Ken Lee’s Blog.

About 6 years ago, I initiated my public blogging on the websites provided by a blog services company. At the beginning I always blogged intermittently and miscellaneously.  On December 2004, I registered the domain name – kenlee.cn and built my first independent blog based on wordpress. However, as the policy which limited the personal user of .CN has been conducted by CNNIC at the end of 2009,  I had to move the domain name to this one – kenlee.cc.  Basically, the old domain name has accumulated plenty of popularities among the Chinese bloggerosphere. Regarding departure from senseless censorship, I think such costs are pretty worthy.

I love blogging. When these years were passing, I have been used to communicating and sharing with others upon weblogs. Also, I found I have been so lucky to meet many soulmates around the amazing blogosphere. It is remarkable that I have taken part in the 1st, 2nd, 3rd and 5th Chinese Blogger Conference respectively held in Shanghai, Hangzhou, Beijing and Lianzhou, which have encouraged me to insist on blogging until today.

What do I blog? It is difficult to figure them out. Generally, I prefer to blogging anything I am interested in, especially, as you can view from the tags, Web2.0 and Edu2.0. Additionally, because I had learned Public Administration at US from 2008 to 2009,  I used to  record my daily American life as well. After all, I never stop attention to the most popular applications on the internet and never stop thinking about the future of internent. Meanwhile, related to my profession and career, I remain enthusiasm towards education and contribute my thoughts about its development. Moreover, as a public intellectual I boast about myself, I deem it is my accountability to speak out the truth and fundamental value of the world via the blog.

Please feel free to comment , or reply on any article of my blog. If you would like to know more about me, recommend you to subscribe this feed, or if you live outside China mainland, please subscribe that feed. Also, welcome to contact me as follows:( PS, strongly recommending to follow @kenlee  on twitter. Thanks!)
Email
del.icio.usflickrGmail/Google TalkPownceTwitterYouTubegoogleshared
Zooomrdoubanjiwaifriendfeedlastfmpicasalinkedin

Go to Top